| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255484.1 | 5prime_partial | 104 | 3-317(+) |
Amino Acid sequence : | |||
| APRFVVSDRANVQRYALVTGANKGIGFEICRQLAEKGIIVILTARNEKRGIEAHQRLLKELNISKNHLVFHQLDVTDPASIAAVAVFIKSTFGKLDILVNNARS* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,479.202 | ||
| Theoretical pI: | 10.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 28.515 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.063 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.192 | ||
| sheet | 0.260 | ||