Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255494.1	5prime_partial	198	3-599(+)
Amino Acid sequence :
QRYALVTGANKGIGFEICRQLAEKGIIVILTARNEKRGIEAHQRLLKELNISKNHLVFHQLDVTDPASIAAVAVFIKSTFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADFNALQALEA GAKEEPPFKPKANGEMIEKFEGAKDCVETNYYGPKRLTQALIPSYNYLLPENRQRLLLLPEFTASMERMGKGNAGGQG*
Physicochemical properties
Number of amino acids:		198
Molecular weight:		21,752.709
Theoretical pI:		6.386
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8940 9065
Instability index:		28.727
aromaticity		0.076
GRAVY		-0.190
Secondary Structure Fraction
Helix		0.308
turn		0.232
sheet		0.313