| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255509.1 | complete | 198 | 2-598(+) |
Amino Acid sequence : | |||
| MREKVQLATKFGIIMGDGKSDVRGDPAYVRSACESSLKRLDVDCINLYYVHRIDTSVPIEVTMGELKKLVEEGKIKYIGLSEASPSTIRRAHAVHPITAVQLEWSLWSRDVEKEIIPTCR ELGIGIVPYSPLGRGFLSLGPKLLENAAEGDFRKDFFPKFQGDNLETNKLVYEKICEMAANKGCSTSHWAWLGSSPRK* | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 22,159.298 | ||
| Theoretical pI: | 8.224 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31190 | ||
| Instability index: | 30.135 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.282 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.237 | ||
| sheet | 0.253 | ||