Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255514.1	5prime_partial	181	1-546(+)
Amino Acid sequence :
NFCTEYPLTIGLMPDGTSRMSTRGQQVYQMLSCSTWSEYTVIDSNYVVKVDPRLSPSRASLLTCGFTTGYGAVWKELKVEKGSTVAVIGLGAVGFGAVNAARIMGASRIIGVDINDMKHK KAKAFGVTDFVNPKKTDKSMSELIQEANGRIGVHYCVQCTGVPSLINEAIASTKMGLREVF*
Physicochemical properties
Number of amino acids:		181
Molecular weight:		19,555.390
Theoretical pI:		8.982
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19940 20190
Instability index:		29.281
aromaticity		0.077
GRAVY		0.006
Secondary Structure Fraction
Helix		0.298
turn		0.254
sheet		0.215