Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255517.1 | 5prime_partial | 180 | 3-545(+) |
Amino Acid sequence : | |||
RSVTYHPSVWRDHFLAYTNDVTEISAAEKEQLEKQKEKVKNLLAQTPNDSTLKIDLIDAIQRLGLGYHFEEEIDGSLRKIRDSYEMLSSKGEDDVRVLALRFRLLRQQGYRAPCEVFNKL VDDEGNFKESLINDVEGMLSLYEASNYGINGEEIMDKALEFSSSHLEDSIQKKPLVFRDE* | |||
Physicochemical properties | |||
Number of amino acids: | 180 | ||
Molecular weight: | 20,777.039 | ||
Theoretical pI: | 4.914 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 28.114 | ||
aromaticity | 0.083 | ||
GRAVY | -0.626 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.200 | ||
sheet | 0.294 |