Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255519.1 | internal | 123 | 3-371(+) |
Amino Acid sequence : | |||
DHEIEVDMVMNKQIVFNNYINGSLKQSDLALRTSTICMEIPDGCNGAILVKNLYLSVNPYLILRMGKLDIPQFDSILPGSTIVSYGVSKVLDSDRIRVTRKAELIWGSQAGWEEYTLIKI HII | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,869.975 | ||
Theoretical pI: | 5.610 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 37.938 | ||
aromaticity | 0.073 | ||
GRAVY | 0.093 | ||
Secondary Structure Fraction | |||
Helix | 0.382 | ||
turn | 0.236 | ||
sheet | 0.220 |