| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255521.1 | internal | 129 | 1-387(+) |
Amino Acid sequence : | |||
| DEDVVLGQYRGYKDDPTVPGDSNTPTFATVILRIHNERWEGVPFILKAGKALNSRKAEIRVQFKDVPGDIFKSLKQGRNEFVIRLQPLEAMYMKLTVKQPGLEMTTAQSELDLSYRQRYQ GAVIPEAYE | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 14,732.633 | ||
| Theoretical pI: | 6.831 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 44.426 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.530 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.202 | ||
| sheet | 0.248 | ||