Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255524.1	5prime_partial	136	3-413(+)
Amino Acid sequence :
SFASAPSTMGDVAADSSMDAVQRRLMFEDECILVDENDHVVGHESKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSTTKVTFPLVWTNTCCSHPLYRDSELIEENALGVRNAAQ RKLLDELGIPAEDVPS*
Physicochemical properties
Number of amino acids:		136
Molecular weight:		15,361.199
Theoretical pI:		4.889
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		47.984
aromaticity		0.074
GRAVY		-0.228
Secondary Structure Fraction
Helix		0.301
turn		0.213
sheet		0.316