| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255526.1 | 5prime_partial | 184 | 1-555(+) |
Amino Acid sequence : | |||
| SVFNEYIEADFKALQALEAGAKEEVPFKPKANGEMIEKFEGAKDCVETNYYGPKRLTQALIPLLQLSPSPRIVNVSSSFGSLLLLWNEWAKGVLGDEDRLTEERVDEVVEVFLKDIKERK LEEIQWPPHFAAERVSKAALNAYTKIVAKKYPSFRINAICPGYAKTDITFHAGPLSVAEAAQFR* | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 11,360.879 | ||
| Theoretical pI: | 9.604 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 54.957 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.018 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.314 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255526.1 | 5prime_partial | 126 | 624-244(-) |
Amino Acid sequence : | |||
| ELVPAPPRGRSSRRAHHQAAEPASPELSSFGHTQWARMEGNVGFRITRAYRIYAETRVLLRHNLSVRVQRRLRNSLRRKMRRPLDFFKLTFFYIFEENLHNFVYSLFCQPILVAEHSLCP FVPQKQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 11,360.879 | ||
| Theoretical pI: | 9.604 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 54.957 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.018 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.314 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255526.1 | complete | 105 | 467-150(-) |
Amino Acid sequence : | |||
| MRKLGYFFATILVYAFNAAFETLSAAKCGGHWISSSLRSFISLRKTSTTSSTLSSVSLSSSPSTPFAHSFHKSSKLPKEEETLTILGEGDNCKRGMRACVSLFGP* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,360.879 | ||
| Theoretical pI: | 9.604 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 54.957 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.018 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.314 | ||
| sheet | 0.248 | ||