| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255531.1 | internal | 218 | 3-656(+) |
Amino Acid sequence : | |||
| RAVLISTQHDETVTNDQIAADLKEHVIKPVIPSQYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSY AIGVAERLSVFVDTYKTGKIPDKDILVLIKENFDFRPGMMAINLHLLKRRNYRYRRMLHTVTLGLMIPTSPGKLSRSSSLRPEFVELIPTTTLLDISK | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 19,930.149 | ||
| Theoretical pI: | 5.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16875 | ||
| Instability index: | 50.187 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.268 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255531.1 | 3prime_partial | 179 | 539-3(-) |
Amino Acid sequence : | |||
| MQHSSVPVVSSFQQVEVDGHHTRPEVEVLLDKHQDILVWNLASLVRINEHRESLRHSNSIRHLHDASTCESRSHNTLCCLPHNVCSTPVHLGRIFARESTSTMSSPSSIGINDDFPTGET SISMGTTNHEATRWVQVEDGLVIKILRWNHGLDHVLLQVSCNLIVCDSLVMLSGDENGT | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 19,930.149 | ||
| Theoretical pI: | 5.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16875 | ||
| Instability index: | 50.187 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.268 | ||
| sheet | 0.207 | ||