Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255531.1 | internal | 218 | 3-656(+) |
Amino Acid sequence : | |||
RAVLISTQHDETVTNDQIAADLKEHVIKPVIPSQYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSY AIGVAERLSVFVDTYKTGKIPDKDILVLIKENFDFRPGMMAINLHLLKRRNYRYRRMLHTVTLGLMIPTSPGKLSRSSSLRPEFVELIPTTTLLDISK | |||
Physicochemical properties | |||
Number of amino acids: | 218 | ||
Molecular weight: | 19,930.149 | ||
Theoretical pI: | 5.802 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16875 | ||
Instability index: | 50.187 | ||
aromaticity | 0.034 | ||
GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.268 | ||
sheet | 0.207 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255531.1 | 3prime_partial | 179 | 539-3(-) |
Amino Acid sequence : | |||
MQHSSVPVVSSFQQVEVDGHHTRPEVEVLLDKHQDILVWNLASLVRINEHRESLRHSNSIRHLHDASTCESRSHNTLCCLPHNVCSTPVHLGRIFARESTSTMSSPSSIGINDDFPTGET SISMGTTNHEATRWVQVEDGLVIKILRWNHGLDHVLLQVSCNLIVCDSLVMLSGDENGT | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 19,930.149 | ||
Theoretical pI: | 5.802 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16875 | ||
Instability index: | 50.187 | ||
aromaticity | 0.034 | ||
GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.268 | ||
sheet | 0.207 |