| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255536.1 | 5prime_partial | 153 | 2-463(+) |
Amino Acid sequence : | |||
| TRGLLQLYEASFLLTEGETTLESAREFATKFLEERVNEGGGDENLLTRIAYSLEIPLHWRIKRPNAPVWIDSYRKRPNMNPVVLDLAILDLNIVQAHFQQELKESFRWWRNTGFVEKLPF ARDRLVECYFWNTGIIEPRQHASARIMMGKVTL* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 17,949.400 | ||
| Theoretical pI: | 6.781 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 43.167 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.190 | ||
| sheet | 0.307 | ||