Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255536.1 | 5prime_partial | 153 | 2-463(+) |
Amino Acid sequence : | |||
TRGLLQLYEASFLLTEGETTLESAREFATKFLEERVNEGGGDENLLTRIAYSLEIPLHWRIKRPNAPVWIDSYRKRPNMNPVVLDLAILDLNIVQAHFQQELKESFRWWRNTGFVEKLPF ARDRLVECYFWNTGIIEPRQHASARIMMGKVTL* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 17,949.400 | ||
Theoretical pI: | 6.781 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
Instability index: | 43.167 | ||
aromaticity | 0.111 | ||
GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.190 | ||
sheet | 0.307 |