| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255537.1 | 5prime_partial | 211 | 2-637(+) |
Amino Acid sequence : | |||
| RPGVIYESDSDRLYEDPVFHMKVFRDAMASHARMTTAVVIENYGEGFRGVGSLVDVGGSYGMALSMLVKAFPWLRGICFDLPEVVARASPLKGIEFVGGSMFESVPKADVVMLMFVLHNW SDEECVEILKRCKDAVSKDTGKVIIIDAIIDEDGDGDEFTGARLGLDVTMMAICPREGPDLRQWAILLTKLAPSALPPKISKLWNPSPGLS* | |||
Physicochemical properties | |||
| Number of amino acids: | 211 | ||
| Molecular weight: | 11,459.971 | ||
| Theoretical pI: | 10.168 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 53.195 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.298 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.349 | ||
| sheet | 0.208 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255537.1 | complete | 106 | 447-127(-) |
Amino Acid sequence : | |||
| MASIMITFPVSFETASLHLFRISTHSSSLQLCNTNMSITTSAFGTLSNMLPPTNSIPLRGDALATTSGRSKHIPRSQGKAFTNIERAIPYEPPTSTKDPTPRKPSP* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,459.971 | ||
| Theoretical pI: | 10.168 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 53.195 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.298 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.349 | ||
| sheet | 0.208 | ||