Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255538.1	5prime_partial	196	1-591(+)
Amino Acid sequence :
AKWIARGEVARPPQLLSVEEGLVVAALGIAGRTYNSRLLDGAWAVLQRSLRQTKLPNPETYLAKIYGLANLGNLPKAFSTLRDFEAAYGNSDREDVDDLFSPFHSLKPLVVACCKDGYTS LDAVYYQLENLSKADLQFKSIAALNCVILGCANIWDVDRAYLTFSAIESSFGLTPNIHSYNGLLCAFGNLARKINC*
Physicochemical properties
Number of amino acids:		196
Molecular weight:		21,497.350
Theoretical pI:		6.928
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		29910 30285
Instability index:		31.072
aromaticity		0.102
GRAVY		0.056
Secondary Structure Fraction
Helix		0.347
turn		0.240
sheet		0.301