| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255539.1 | 5prime_partial | 181 | 2-547(+) |
Amino Acid sequence : | |||
| LNHTISDAAGLAQFLSAVAELARGAEAPTFLPVWRRELLSARDPPRVTCTHHEFGVVSGATFTPPANMVERGFFFSPADIAALRSTLPPHLRRRTSAFQIAVACAWRCRVIALSPDPSEE IRISCIVNCRNRFDPPLPEGYYGNAMVNPPPSPRQGRLCASPFGVPVELVRNANPRRRKST* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 12,336.885 | ||
| Theoretical pI: | 11.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 85.566 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.551 | ||
Secondary Structure Fraction | |||
| Helix | 0.221 | ||
| turn | 0.301 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255539.1 | 3prime_partial | 153 | 145-603(+) |
Amino Acid sequence : | |||
| MHAPRIRRRLRRYFYPTRQHGRARLLLQPRRHRRPPQHPTAASPPPHLRLPDRGRLRMAVPGDRPLSGPQRRDQDLVHSELPESIRSAAAGRILRQRHGQPAAVAAAGKIVREPVWSTRG TGAERKSQAKEEYLKSVADLLLLRGSPLAGRRG | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 12,336.885 | ||
| Theoretical pI: | 11.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 85.566 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.551 | ||
Secondary Structure Fraction | |||
| Helix | 0.221 | ||
| turn | 0.301 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255539.1 | complete | 123 | 378-7(-) |
Amino Acid sequence : | |||
| MHEILISSLGSGERAITRHRHAQATAIWKAEVRRRRCGGRVLRRAAMSAGLKKKPRSTMLAGGVKVAPETTPNSWCVHVTRGGSRALRSSLRQTGRNVGASAPRASSATADRNWANPAAS LIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 12,336.885 | ||
| Theoretical pI: | 11.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 85.566 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.551 | ||
Secondary Structure Fraction | |||
| Helix | 0.221 | ||
| turn | 0.301 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255539.1 | 5prime_partial | 113 | 601-260(-) |
Amino Acid sequence : | |||
| PASLPAGFPLITINPPRISSTLPSPGICVPHQFHGYSKRARAQSSLPRRRRRVDHGVAVVSFRQRRIESIPAVHYARDPDLFAGVRREGDHPAPPCAGDRDLEGGGAAAEMRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,336.885 | ||
| Theoretical pI: | 11.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 85.566 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.551 | ||
Secondary Structure Fraction | |||
| Helix | 0.221 | ||
| turn | 0.301 | ||
| sheet | 0.212 | ||