Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255544.1 | 5prime_partial | 165 | 2-499(+) |
Amino Acid sequence : | |||
SCRRKRPDMNPVVLELAILDLNIVQAQFQEELKESFRWWRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDVYGTLEELEQFTELIRRWDIDSIDQLP DYMQLCFLALNNFVDETSYDVMKEKGVTLYPTCGNRGWIWRISIW* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 19,648.369 | ||
Theoretical pI: | 4.883 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47440 47690 | ||
Instability index: | 49.358 | ||
aromaticity | 0.127 | ||
GRAVY | -0.227 | ||
Secondary Structure Fraction | |||
Helix | 0.376 | ||
turn | 0.164 | ||
sheet | 0.248 |