| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255545.1 | complete | 192 | 40-618(+) |
Amino Acid sequence : | |||
| MVMNKQIVLNNYINGSLKQSDLALRTSTICMEIPDGCNGAILVKNLYLSVNPYLILRMGKLDIPQFDSILPGSTIVSYGVSKVLDSTHPSYEKGELIWGSQAGWEEYTLIQNPYNLFKIQ DKDVPLSYYVGILGMPGMTAYAGFFEICSPKKGETVFVTAAAGSVGQLVGQFAKILGAMLLEXQGAERRLIF* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 20,956.159 | ||
| Theoretical pI: | 5.829 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
| Instability index: | 32.643 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.267 | ||
| sheet | 0.257 | ||