Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255545.1 | complete | 192 | 40-618(+) |
Amino Acid sequence : | |||
MVMNKQIVLNNYINGSLKQSDLALRTSTICMEIPDGCNGAILVKNLYLSVNPYLILRMGKLDIPQFDSILPGSTIVSYGVSKVLDSTHPSYEKGELIWGSQAGWEEYTLIQNPYNLFKIQ DKDVPLSYYVGILGMPGMTAYAGFFEICSPKKGETVFVTAAAGSVGQLVGQFAKILGAMLLEXQGAERRLIF* | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 20,956.159 | ||
Theoretical pI: | 5.829 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
Instability index: | 32.643 | ||
aromaticity | 0.099 | ||
GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
Helix | 0.366 | ||
turn | 0.267 | ||
sheet | 0.257 |