| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255552.1 | internal | 207 | 3-623(+) |
Amino Acid sequence : | |||
| KIKMAPKEDSLALAEAWNHGFGFIKTSIVKTAVELEIPDILESRGAPISIPELAAAVDCSADRLFRVMRFLAYHGIFKRTKPPPESTGSSSVYYAQTPVSRRLTRENLGPFVLLQGTMKE PSGCVTAETLRTSKRPGVIYESDSDRLYEDPVFHMKVFRDAMASHARMTTAVVIETTAKVSEESGLWWMSRFVRNGLSMLVKAFLGF | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 12,229.597 | ||
| Theoretical pI: | 11.471 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 71.184 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.338 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.279 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255552.1 | 5prime_partial | 143 | 623-192(-) |
Amino Acid sequence : | |||
| EAKESLHQHRETIPYEPRHPPKTRLFGNLRRSFDHHRRRHPSMARHSIPKNLHMENWIFVQAVRVALIDNAGSFARPQGLRRHTPGRLFHGALKQHEGPQILPSEAARDRGLSVVDRTAP GRLGWRLGSLEDAVIGKEPHDSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 12,229.597 | ||
| Theoretical pI: | 11.471 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 71.184 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.338 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.279 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255552.1 | 5prime_partial | 104 | 2-316(+) |
Amino Acid sequence : | |||
| KNKNGTERRFTSFGRSMEPWLRFHQNQHSQDCRRARDTRHPRKPWSSDLDTGASRRCRLLRRPPIPSHEVPCLSRHLQENQAATRVDREQFGLLRSNPGLAPPH* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,229.597 | ||
| Theoretical pI: | 11.471 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 71.184 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.338 | ||
Secondary Structure Fraction | |||
| Helix | 0.173 | ||
| turn | 0.279 | ||
| sheet | 0.192 | ||