Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255559.1	5prime_partial	171	3-518(+)
Amino Acid sequence :
GFVTGYMTFMSIGGFPSFVEEMKVFYRERLNGYYGVGVFILSNFFSSLPFLIAISAISGTITFFMVKYESEFSRYAFFCLNLFGCIAMVESVMMIVASLVPNFLMGIIAGAGVLGIMMMT AGFFRLLPDLPKIFWRYPISYIGYGAWSLQGGFKNDMLGLVFDPLFRVIQR*
Physicochemical properties
Number of amino acids:		171
Molecular weight:		19,267.757
Theoretical pI:		8.602
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		24410 24535
Instability index:		27.782
aromaticity		0.193
GRAVY		0.814
Secondary Structure Fraction
Helix		0.450
turn		0.257
sheet		0.251