| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255565.1 | 5prime_partial | 156 | 1-471(+) |
Amino Acid sequence : | |||
| RHERHEVFVTAAAGSVGQLVGQFAKMFGCYVVGSAGSKEKVDLLKNKFGFDDAFNYKEESDYDTALKRHFPEGIDIYFDNVGGKMLEAVINNMRVHGRIAVCGMVSQYSLKQPEGVHNLL KLIPKQIRMQGFVVVDYYISTQSSLRWFCRASRKEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 17,690.140 | ||
| Theoretical pI: | 9.117 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 36.210 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.276 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.212 | ||
| sheet | 0.218 | ||