Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255570.1	5prime_partial	199	2-601(+)
Amino Acid sequence :
KGRKVKMVADEEVRVRAEAWNNAFGYIKPTAVATAVELGLPDILENHDGPMSLLELSAATDCPAEPLHRLMRFLVFHGIFKKTAKPPLSNEAVYYARTALSRLFTRDELGDFMLLQTGPL SQHPAGLTASSLKNREAPVHQVGQRRRPWTDPVNGYHMKVFSDAMAAHARETTAGSPLLSAAFQGIGTVVDFGGAMGLL*
Physicochemical properties
Number of amino acids:		199
Molecular weight:		13,272.938
Theoretical pI:		10.612
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		54.499
aromaticity		0.068
GRAVY		-0.617
Secondary Structure Fraction
Helix		0.282
turn		0.256
sheet		0.222

Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255570.1	complete	117	472-119(-)
Amino Acid sequence :
MITVNRVGPRSSPLTDLMNWGFPVFQRTGGQTGRVLRQRAGLEQHEIPQLIPREETRERRPSVVNGFVRERWFSGFLEDAMEYQKPHKPVERLSGAVGGGGELQQRHGAVVVLQDVR*
Physicochemical properties
Number of amino acids:		117
Molecular weight:		13,272.938
Theoretical pI:		10.612
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		54.499
aromaticity		0.068
GRAVY		-0.617
Secondary Structure Fraction
Helix		0.282
turn		0.256
sheet		0.222