Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255571.1	complete	128	17-403(+)
Amino Acid sequence :
MAGMERLHRMFAGAGGALGHPPPDSPTLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPG FGMLAFWC*
Physicochemical properties
Number of amino acids:		128
Molecular weight:		13,983.128
Theoretical pI:		5.561
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15470
Instability index:		30.845
aromaticity		0.086
GRAVY		0.128
Secondary Structure Fraction
Helix		0.297
turn		0.250
sheet		0.313