| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255583.1 | 5prime_partial | 192 | 2-580(+) |
Amino Acid sequence : | |||
| HTRNSPNLRSSLPFVKTVEDKMARKKIREYDSKRLLKEHFKRISGSDLEIKSAQVTESTDFNQLVDKEPWLSSTRLVVKPDMLFGKRGKSGLVALNLDLAGVAAFVKERLGKEVEMGGCK GPITTFIVEPFIPHNEEYYLNIVSDRLGCSISFSECGRIDIEENWGKVKTMLVPTGTLSHQNYVLHLLQPFP* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 21,720.820 | ||
| Theoretical pI: | 8.931 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 42.910 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.348 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.245 | ||
| sheet | 0.240 | ||