| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255610.1 | internal | 160 | 3-482(+) |
Amino Acid sequence : | |||
| KQAPMADAQRHALVTGANKGIGFEICRQLAEKGIIVILTARNEKRGIEAQQKLLKELNVSENHLVFHQLDVTDPASVAAIAVFVKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADF KALQALEAGAKEEVPFKPESKWRNDRKIRGSQRLRGNKLL | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 17,620.111 | ||
| Theoretical pI: | 9.240 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 29.554 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.224 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.200 | ||
| sheet | 0.300 | ||