Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255610.1	internal	160	3-482(+)
Amino Acid sequence :
KQAPMADAQRHALVTGANKGIGFEICRQLAEKGIIVILTARNEKRGIEAQQKLLKELNVSENHLVFHQLDVTDPASVAAIAVFVKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADF KALQALEAGAKEEVPFKPESKWRNDRKIRGSQRLRGNKLL
Physicochemical properties
Number of amino acids:		160
Molecular weight:		17,620.111
Theoretical pI:		9.240
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		29.554
aromaticity		0.056
GRAVY		-0.224
Secondary Structure Fraction
Helix		0.306
turn		0.200
sheet		0.300