| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255613.1 | 3prime_partial | 143 | 16-444(+) |
Amino Acid sequence : | |||
| MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTIVLAVEKKSTPKLQDSRSVRKIVNLDDHIALACAGLKADARVLINKARIECQSYKLTIEDPVTVEYITRYIAGLQQKYT QSGGVRPFGLSTLIIGFDPHTGT | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 15,692.853 | ||
| Theoretical pI: | 9.143 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 45.707 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.099 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.182 | ||
| sheet | 0.231 | ||