| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255628.1 | internal | 134 | 2-403(+) |
Amino Acid sequence : | |||
| FGELGEDCSKEVKEVLTYVERDDILPPILVLQTLSRNPCLTLSVIKDYIARKLEQESKRIEEDRTAIEKYQEETSMMRKEIQDLRTNARIFQLSKCTACTFTLDLPTVHFMCMHSFHQRC LGDNEKECPECAPE | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,604.759 | ||
| Theoretical pI: | 5.067 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4970 | ||
| Instability index: | 72.749 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.496 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.142 | ||
| sheet | 0.299 | ||