Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255628.1 | internal | 134 | 2-403(+) |
Amino Acid sequence : | |||
FGELGEDCSKEVKEVLTYVERDDILPPILVLQTLSRNPCLTLSVIKDYIARKLEQESKRIEEDRTAIEKYQEETSMMRKEIQDLRTNARIFQLSKCTACTFTLDLPTVHFMCMHSFHQRC LGDNEKECPECAPE | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 15,604.759 | ||
Theoretical pI: | 5.067 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4970 | ||
Instability index: | 72.749 | ||
aromaticity | 0.060 | ||
GRAVY | -0.496 | ||
Secondary Structure Fraction | |||
Helix | 0.269 | ||
turn | 0.142 | ||
sheet | 0.299 |