| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255632.1 | 5prime_partial | 158 | 2-478(+) |
Amino Acid sequence : | |||
| LRLPVIGHFHLIGALSHRSFTSLSKRYGEVMLLHFGSAPVLVASSAAAAREIMKNQDVIFASRPRLSIFDRLMYSGKGVAFAPYGEHWRNARSMCMLQLLSAKRVQSFGGIREEETSAMI EKIRRSKPTTVVNLSEMFMALTNGVFPGRCFGRKATRK* | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 17,662.538 | ||
| Theoretical pI: | 10.915 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 49.340 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.030 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.241 | ||
| sheet | 0.291 | ||