Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255633.1	5prime_partial	172	2-520(+)
Amino Acid sequence :
LVCWQHSSLEREREMAGGLSVGRIGDVAKEYQGKVTAYVIITCILASVGGSLFGYDVGISGGVTSMDEFLHKFFYKVYLTKINGAPQPQSNYCKYSDQSLAAFTSSLYLSGLAASLAASP ITKKYGRRKSILCGGVTFLVGATLNAAAANLPMLLLGRIMLGVGIGFRNQVN*
Physicochemical properties
Number of amino acids:		172
Molecular weight:		18,330.079
Theoretical pI:		9.343
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18910 19160
Instability index:		30.549
aromaticity		0.099
GRAVY		0.287
Secondary Structure Fraction
Helix		0.349
turn		0.273
sheet		0.262