Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255636.1 | 5prime_partial | 169 | 1-510(+) |
Amino Acid sequence : | |||
IGKALKGGMREKVQLATKFGIIMGDGKSDVRGDPAYVRSACESSLKRLDVDCINLYYVHRIDTSVPIEVTMGELKKLVEEGKIKYIGLSEASPSTIRRAHAVHPITAVQLEWSLWSRDVE KEIIPTCRELGIGIVPYSPLGRGFLSLGPKLLENAQKVTFARISFRGPG* | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 18,608.481 | ||
Theoretical pI: | 9.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 28.581 | ||
aromaticity | 0.065 | ||
GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.243 | ||
sheet | 0.243 |