| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255636.1 | 5prime_partial | 169 | 1-510(+) |
Amino Acid sequence : | |||
| IGKALKGGMREKVQLATKFGIIMGDGKSDVRGDPAYVRSACESSLKRLDVDCINLYYVHRIDTSVPIEVTMGELKKLVEEGKIKYIGLSEASPSTIRRAHAVHPITAVQLEWSLWSRDVE KEIIPTCRELGIGIVPYSPLGRGFLSLGPKLLENAQKVTFARISFRGPG* | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 18,608.481 | ||
| Theoretical pI: | 9.300 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 28.581 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.243 | ||
| sheet | 0.243 | ||