| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255639.1 | 5prime_partial | 138 | 1-417(+) |
Amino Acid sequence : | |||
| LIGKALKGGMREKVQLATKFGIIMGDGKSDVRGDPAYVRSACESSLKRLDVDCINLYYVHRIDTSVPIEVTMGELKKLVEEGKIKYIGLSEASPSTIRRAHAVHPITAVQLEWSLWSRDV QKEIIPTCRRTWYWNSPI* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 11,240.831 | ||
| Theoretical pI: | 8.542 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 51.628 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.125 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.253 | ||
| sheet | 0.172 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255639.1 | 5prime_partial | 99 | 626-327(-) |
Amino Acid sequence : | |||
| EQIISLVRTQPRPVRCVQPLLAPISQIFCTRVVVSRCHPGTSERNPCESHLLLRSPATWGPTKGIRVQEDYMGLFQYQVLLQVGIISFWTSLDHNDHSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,240.831 | ||
| Theoretical pI: | 8.542 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 51.628 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.125 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.253 | ||
| sheet | 0.172 | ||