Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255639.1 | 5prime_partial | 138 | 1-417(+) |
Amino Acid sequence : | |||
LIGKALKGGMREKVQLATKFGIIMGDGKSDVRGDPAYVRSACESSLKRLDVDCINLYYVHRIDTSVPIEVTMGELKKLVEEGKIKYIGLSEASPSTIRRAHAVHPITAVQLEWSLWSRDV QKEIIPTCRRTWYWNSPI* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 11,240.831 | ||
Theoretical pI: | 8.542 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 51.628 | ||
aromaticity | 0.071 | ||
GRAVY | -0.125 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.253 | ||
sheet | 0.172 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255639.1 | 5prime_partial | 99 | 626-327(-) |
Amino Acid sequence : | |||
EQIISLVRTQPRPVRCVQPLLAPISQIFCTRVVVSRCHPGTSERNPCESHLLLRSPATWGPTKGIRVQEDYMGLFQYQVLLQVGIISFWTSLDHNDHSS* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,240.831 | ||
Theoretical pI: | 8.542 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 51.628 | ||
aromaticity | 0.071 | ||
GRAVY | -0.125 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.253 | ||
sheet | 0.172 |