| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255642.1 | complete | 173 | 38-559(+) |
Amino Acid sequence : | |||
| MGVNVPRIKLGSQGLEVSKQGLGCMGMSAFYGPPKPDSDMIKLIHHAIDSGVTFLDTSDMYGPHTNEILIGKALKGGMREKVQLATKFGIIMGVGKNDVRGDPAYVRSSCESSLKRLDVD CIDLYYVHRIDTSVPIEVTMGELKKLVEEGKIKYIRLSEASPSTIKRAMLCIQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 18,946.982 | ||
| Theoretical pI: | 8.623 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9190 | ||
| Instability index: | 35.205 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.249 | ||
| sheet | 0.231 | ||