| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255643.1 | complete | 191 | 39-614(+) |
Amino Acid sequence : | |||
| MGVNVPRIKLGSQGLEVSKQGLGCMGMSAFYGPPKPDSDMINLIHHAIDSGVTFLDTSDMYGPHTNEILIGKALKGGMREKVQLATKFGIIMGVGKSDVRGDPAYVRSSCESSLKRLDVD CIDLYYXHRIDTSVPIEVTMGELKKLVEEGKIKYIRLSEASPSTIRRAHAVHPITAVQIKWSLWSKMPNHK* | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 20,937.148 | ||
| Theoretical pI: | 9.081 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 41.715 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.202 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.258 | ||
| sheet | 0.221 | ||