| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255646.1 | 5prime_partial | 161 | 1-486(+) |
Amino Acid sequence : | |||
| PKSASPNFAKMGVNVPKIKLGSQGLEVSKQGLGCMGMSAFYGLPKPEPDMIKLLHHAIDSGVTFLDTSDMYGPHTNEILIGKALKGGMREKVQLATKFGIIMGDGKSDVRGDPAYVRSAC ESGLKRLDIDCIDLYYVHRIDTSVPIEVRWGSLRNWSKKGK* | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 11,709.116 | ||
| Theoretical pI: | 6.632 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 63.105 | ||
| aromaticity | 0.127 | ||
| GRAVY | -0.418 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.304 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255646.1 | complete | 102 | 544-236(-) |
Amino Acid sequence : | |||
| MNSMALLIVEGEASESPMYFIFPSSTSFLSSPIGLQWAQKYQCDEHNRDRCSQYQDASSPTHMLTSHMPGHHVRHSSHLPLLFQTWWQAAPFPSFPLSKPFR* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,709.116 | ||
| Theoretical pI: | 6.632 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 63.105 | ||
| aromaticity | 0.127 | ||
| GRAVY | -0.418 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.304 | ||
| sheet | 0.235 | ||