Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255646.1 | 5prime_partial | 161 | 1-486(+) |
Amino Acid sequence : | |||
PKSASPNFAKMGVNVPKIKLGSQGLEVSKQGLGCMGMSAFYGLPKPEPDMIKLLHHAIDSGVTFLDTSDMYGPHTNEILIGKALKGGMREKVQLATKFGIIMGDGKSDVRGDPAYVRSAC ESGLKRLDIDCIDLYYVHRIDTSVPIEVRWGSLRNWSKKGK* | |||
Physicochemical properties | |||
Number of amino acids: | 161 | ||
Molecular weight: | 11,709.116 | ||
Theoretical pI: | 6.632 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 63.105 | ||
aromaticity | 0.127 | ||
GRAVY | -0.418 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.304 | ||
sheet | 0.235 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255646.1 | complete | 102 | 544-236(-) |
Amino Acid sequence : | |||
MNSMALLIVEGEASESPMYFIFPSSTSFLSSPIGLQWAQKYQCDEHNRDRCSQYQDASSPTHMLTSHMPGHHVRHSSHLPLLFQTWWQAAPFPSFPLSKPFR* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,709.116 | ||
Theoretical pI: | 6.632 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 63.105 | ||
aromaticity | 0.127 | ||
GRAVY | -0.418 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.304 | ||
sheet | 0.235 |