Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255647.1 | 5prime_partial | 186 | 3-563(+) |
Amino Acid sequence : | |||
SLKRLDVDCIDLYYVHRIDTSVPIEVTMGELKKLVEEGKIKYIGLSEASPSTIRRAHAVHPITAVQLEWSLWSRDVEQEIIPTCRELGIGIVPYSPLGRGFLSLGPKLLENAAEGDLRKD FFPRFQGDNLEKNKLVYEKICEMAASKGCSTSQLALAWVHHQGDDVAPIPGTTKIENFNDNVGPSP* | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 20,670.409 | ||
Theoretical pI: | 5.560 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
Instability index: | 30.825 | ||
aromaticity | 0.070 | ||
GRAVY | -0.244 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.242 | ||
sheet | 0.253 |