| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255650.1 | 5prime_partial | 181 | 3-548(+) |
Amino Acid sequence : | |||
| DSKAKSAVIGGVSVNISEIVGKVGTSSIEEKFPLNLQIDGIARDAFLTVMFNFVEIRESQDSATTNRTKSVDIKHSFVDECKDNVKARRRSLSLEEVCLDDSEESKSRVSTTAPESGRKD RWFAWKSRRFSFQRAQTKEEKSKIAVTRARSKIGVFNRLISLPEIRSTSALCRQMIRQNPI* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 20,509.363 | ||
| Theoretical pI: | 8.553 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 44.409 | ||
| aromaticity | 0.105 | ||
| GRAVY | 0.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.227 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255650.1 | 3prime_partial | 181 | 544-2(-) |
Amino Acid sequence : | |||
| MGFCRIIWRQRALVERISGRLINRLKTPIFDLALVTAIFDFSSLVWARWKLNRLLFQANHRSFLPDSGAVVETLDFDSSESSKHTSSKLKDLLRAFTLSLHSSTNECFMSTDFVRFVVAE SWDSLISTKLNITVRKASLAIPSICRLRGNFSSIEEVPTFPTISDILTETPPITADFAFES | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 20,509.363 | ||
| Theoretical pI: | 8.553 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 44.409 | ||
| aromaticity | 0.105 | ||
| GRAVY | 0.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.227 | ||
| sheet | 0.243 | ||