| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255651.1 | internal | 210 | 3-632(+) |
Amino Acid sequence : | |||
| EKVQLATKFGIIMGDGKSDVRGDPAYVRSACESSLKRLDVDCIDLYYVHRIDTSVPIEVTMGELKKLVEEGKIKYIGLSEASPSTIRRAHAVHPITAVQLEWSLWSRDVEQEIIPTCREL GIGIVPYSPLGRGFLSLGPKLLENAAEGDLRKDFFPKFQGDNLETNKLVYEKIVKWPQQRLQHSQLALAWVLPRREVAPIPGNTKIENFN | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 12,266.052 | ||
| Theoretical pI: | 9.620 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 51.432 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.385 | ||
| turn | 0.202 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255651.1 | 5prime_partial | 104 | 632-318(-) |
Amino Acid sequence : | |||
| VEVFDFGVPRYRSNFSPWENPSQRQLRVLQPLLRPFHNLLVHELVRLEIVTLELRKEILAKVAFCCVLQQLGAQRKESASKRTIWDYSNTKFSASRNYFLLDIS* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,266.052 | ||
| Theoretical pI: | 9.620 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 51.432 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.385 | ||
| turn | 0.202 | ||
| sheet | 0.260 | ||