Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255655.1 | complete | 164 | 29-523(+) |
Amino Acid sequence : | |||
MGVNVPRIKLGSQGLEVSKQGLGCMGMSAFYGPPKPDSDMIKLIHHAIDSGVTFLDTSDMYGPHTNEILIGKALKGGMREKVQLATKFGIIMGVGKSDVRGDPAYVRSSCESSLKRLDVD CIDLYYVHRIDTSVPIEVTMGELKKLVEEGKIKYSGSQSLSFNN* | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 17,842.462 | ||
Theoretical pI: | 7.705 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
Instability index: | 33.944 | ||
aromaticity | 0.061 | ||
GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.280 | ||
sheet | 0.213 |