Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255657.1 | complete | 173 | 39-560(+) |
Amino Acid sequence : | |||
MGVNVPRIKLGSQGLEVSKQGLGCMGMSAFYGPPKPDSDMIKLIHHAIDSGVTFLDTSDMYGPHTKEILIGKALKGGMREKVQLATKFGIIMGVGKNDVHGDPAYVRSSSESSLKRLDVD CIHLYYVHPIDTSVPIEVTMGELKKLVEERKIKYIRLSEASPSTIKRAMLCIP* | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 18,957.041 | ||
Theoretical pI: | 8.913 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
Instability index: | 37.179 | ||
aromaticity | 0.052 | ||
GRAVY | -0.115 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.254 | ||
sheet | 0.231 |