Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255673.1 | internal | 174 | 2-523(+) |
Amino Acid sequence : | |||
ILRKYRRKKVGDDETNFVDTLLQFQRESKDTDPVEDDVIKALIFDMVSAGTDTTFAALEWTMAELIKNPRTLKTLQNEVREVSRNKGGITEDDVDKMPFLKAVSKEILRLHPPFAILLPR ELTLDAHMLGYEIPPGTVVFVNNWGVSRDPPCGKIPKNFLHKRSSKGGAVPIPH | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 19,664.455 | ||
Theoretical pI: | 8.020 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 35.017 | ||
aromaticity | 0.069 | ||
GRAVY | -0.399 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.213 | ||
sheet | 0.236 |