Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255675.1 | 5prime_partial | 142 | 1-429(+) |
Amino Acid sequence : | |||
VFSLYSISSALQESVKMVKNYPVVSEEYLKAVDKCKRKLRGLIAEKNCAPIMLRLAWHSAGTFDQCSKTGGPFGTMRFDAELAHGANNGLDIALRLLEPIRKQFPSISFADFYQLAGVVA VEITGGPDVPFPQEGGQGRTTC* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,484.679 | ||
Theoretical pI: | 8.393 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 43.907 | ||
aromaticity | 0.092 | ||
GRAVY | -0.063 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.246 | ||
sheet | 0.261 |