| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255676.1 | internal | 168 | 3-506(+) |
Amino Acid sequence : | |||
| AYAGFFEICSPKKGETVFVTAAAGSVGQLVGQFAKMFGCYVVGSAGSKEKVDLLKNKFGFDDAFNYKEESDYDTALKRHFPQGIDIYFDNVGGKMLETVINNMRVHGRIPVCGMVSPYSL KQPERVPNMLKLIPEQIPMPGFVLVDYYHLYPNSLKWFCPCLRKEKLI | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,906.827 | ||
| Theoretical pI: | 8.544 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
| Instability index: | 36.655 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.244 | ||
| sheet | 0.220 | ||