Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255676.1 | internal | 168 | 3-506(+) |
Amino Acid sequence : | |||
AYAGFFEICSPKKGETVFVTAAAGSVGQLVGQFAKMFGCYVVGSAGSKEKVDLLKNKFGFDDAFNYKEESDYDTALKRHFPQGIDIYFDNVGGKMLETVINNMRVHGRIPVCGMVSPYSL KQPERVPNMLKLIPEQIPMPGFVLVDYYHLYPNSLKWFCPCLRKEKLI | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 18,906.827 | ||
Theoretical pI: | 8.544 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
Instability index: | 36.655 | ||
aromaticity | 0.131 | ||
GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.244 | ||
sheet | 0.220 |