| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255678.1 | 5prime_partial | 105 | 1-318(+) |
Amino Acid sequence : | |||
| NTGIIEPRQHASARIMMGKVNALITVIDDIYDVYGTLEELEHFTDLIRRWDIDSIDQLPDYMQLCFLALNNFVDETSYDVMKEKGVYVIPYLRQSWVDLADKYMV* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,309.948 | ||
| Theoretical pI: | 4.395 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 37.142 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.089 | ||
Secondary Structure Fraction | |||
| Helix | 0.390 | ||
| turn | 0.143 | ||
| sheet | 0.248 | ||