| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255683.1 | 5prime_partial | 140 | 2-424(+) |
Amino Acid sequence : | |||
| ETQSKGAEIYHGPISIEKVDEMLEEFSVPKCLFLGLKADLVEEFGFNRSTGFYWLKQKSKTERKLDKIRTTAYYDTQVSGFIQPRRLSKITGVKAKELFLTLTVTEILVGIPSTDKVKFV STTGIYRTLPIAAFEEKNLL* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,916.248 | ||
| Theoretical pI: | 8.936 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 33.402 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.204 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.179 | ||
| sheet | 0.250 | ||