Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255683.1 | 5prime_partial | 140 | 2-424(+) |
Amino Acid sequence : | |||
ETQSKGAEIYHGPISIEKVDEMLEEFSVPKCLFLGLKADLVEEFGFNRSTGFYWLKQKSKTERKLDKIRTTAYYDTQVSGFIQPRRLSKITGVKAKELFLTLTVTEILVGIPSTDKVKFV STTGIYRTLPIAAFEEKNLL* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,916.248 | ||
Theoretical pI: | 8.936 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 33.402 | ||
aromaticity | 0.107 | ||
GRAVY | -0.204 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.179 | ||
sheet | 0.250 |