| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255687.1 | 3prime_partial | 130 | 390-1(-) |
Amino Acid sequence : | |||
| MQSTSRRFKLDSHADLNICRVTTYVTLPISHYYSKLGGKLHLFPHSPFQSLSDKNFVSVGTVHVGGVEEGDAGVDGVVEELDHIRLRLRQAVESRHAHAPQPVLRHLEPLRSKLNFRHVH SHFREIRACR | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 12,164.733 | ||
| Theoretical pI: | 9.686 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 61.352 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.355 | ||
| sheet | 0.173 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255687.1 | 5prime_partial | 118 | 1-357(+) |
Amino Acid sequence : | |||
| STSPNFAKMGVNVPKIKLGSQGLEVSKHGLGCMGMSAFYGLPKPEPDMIKLLHHAIDSGVTFLDTSDMYGPHTNEILIGKALKGGMREKVQLATKFGIIMGDGKSDVRGDPAYVEVSM* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,164.733 | ||
| Theoretical pI: | 9.686 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 61.352 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.355 | ||
| sheet | 0.173 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255687.1 | complete | 110 | 446-114(-) |
Amino Acid sequence : | |||
| MVTSNGHRSINADEHNRDRCSQHQDASSSTHMLTSTYAGSPRTSLFPSPIIIPNLVASCTFSLIPPFKAFPIRISLVWGPYMSEVSRKVTPESMAWWRSLIISGSGFGRP* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,164.733 | ||
| Theoretical pI: | 9.686 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 61.352 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.355 | ||
| sheet | 0.173 | ||