| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255698.1 | 5prime_partial | 171 | 2-517(+) |
Amino Acid sequence : | |||
| KSLTRLGARKFISLYQEDDSHNEILLNFAKLDFNIVQKMHQRELSDATRWWKKLDVANKMPYARDRNVECFFWMVGVYFEPCYATARKILLKCISMASIIDDTYEYATLHELQILTDAIQ RWDVNEALEDSPPYIQMCYRSLIQTYVEIEDEVVEKFGGDRHTVSNMPYKI* | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 11,541.108 | ||
| Theoretical pI: | 6.754 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 69.239 | ||
| aromaticity | 0.150 | ||
| GRAVY | 0.250 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.260 | ||
| sheet | 0.170 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255698.1 | 5prime_partial | 100 | 628-326(-) |
Amino Acid sequence : | |||
| GHCHITTDTIEPSYILPRGNISSNIHFASSIYAHTDFSYLVWHIGHGMTISSKFLHNFIFYFNISLNKASVAHLYIWWRILQCLINIPTLDSVGENLQFM* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,541.108 | ||
| Theoretical pI: | 6.754 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 69.239 | ||
| aromaticity | 0.150 | ||
| GRAVY | 0.250 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.260 | ||
| sheet | 0.170 | ||