Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255705.1	internal	208	1-624(+)
Amino Acid sequence :
EQAAMAEVQRYALVTGANKGIGFEICRQLAEKGIIVILTSRNEKRGLEARQKLLKELNVSENRLVFHQLDVTDLASVAAVAVFIKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADF KALQALEAGAKEEPPFKPKANGEMIEKFEGAKDCVVTNYYGPKRLTQALIPLLQLSPSPRIVNVSPPSGVTATVEQMGKGVLATRXAD
Physicochemical properties
Number of amino acids:		208
Molecular weight:		22,386.609
Theoretical pI:		6.923
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 6085
Instability index:		30.215
aromaticity		0.058
GRAVY		-0.026
Secondary Structure Fraction
Helix		0.314
turn		0.217
sheet		0.314