| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255710.1 | 3prime_partial | 188 | 47-610(+) |
Amino Acid sequence : | |||
| MYTALQKIHKEKDAEPTEFEENVAQALFDLENTNGEIKSDLKDLYINSAVQIDVPGGKKAVVIHVPYRLRKSFRKIHSRLVRELEKKLSGKDVIILATRRIVRPPKKGSAAQRPRSRTLT SVHEAMLEDVVYPAEIVGKRVRYRLHGSKIMKVFLDPQARNNTENKLETFSGVYRKLSGKKVVFEFPL | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 17,752.084 | ||
| Theoretical pI: | 9.504 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 62.351 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.099 | ||
Secondary Structure Fraction | |||
| Helix | 0.353 | ||
| turn | 0.314 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255710.1 | complete | 156 | 484-14(-) |
Amino Acid sequence : | |||
| MESVSDTLSNNLSWVNYVFEHSFMNRSESPGSRSLSCRALLWWTHNPSSSKDNNILSTQLLLKFSHQPRMNLAERFPQSVRYMDHNSFLASRDINLHSRVDVEVLQITLNFSIGVLQIKQ SLSNIFLKLGGLSILFLVNLLQSGIHGCTFRNLAGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 17,752.084 | ||
| Theoretical pI: | 9.504 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 62.351 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.099 | ||
Secondary Structure Fraction | |||
| Helix | 0.353 | ||
| turn | 0.314 | ||
| sheet | 0.237 | ||