| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255714.1 | internal | 187 | 1-561(+) |
Amino Acid sequence : | |||
| RHLPRPQRRPPRQPRRPGPLRRRRRRRHRRLRPHRRRRAPPLRAGLRRPDDPPRQRRRHRRPPPGGGPHLPPPQGRARADLEEHREESEGGLRPLGDFRLELRFLDRPPRGGRHPPTGGV QAGAEARETEFTPHVLSEYGNMSSACVLFILDEMKKSPPGRAELPREGLDWGVLFGFGRAPVEKGSF | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 12,270.571 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 85.666 | ||
| aromaticity | 0.071 | ||
| GRAVY | -1.156 | ||
Secondary Structure Fraction | |||
| Helix | 0.133 | ||
| turn | 0.469 | ||
| sheet | 0.115 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255714.1 | internal | 187 | 561-1(-) |
Amino Acid sequence : | |||
| EGPLFHGSPAETEQNPPVQPFPGEFSPSRGRFLHFIKNEQNAGARHVPVLAQHVGREFSFSGFSPSLDSTCWRMAAPPGWAIQKTEFQSEIPKGAKASFRLFSMFFEISPGTSLRRWKVR PTSRRWPSMAPSLSGRIVWAAETSSKRGRSTPTMGSEPTMTAAAPSPKRAWPTRLSRWASLGPRKVT | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 12,270.571 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 85.666 | ||
| aromaticity | 0.071 | ||
| GRAVY | -1.156 | ||
Secondary Structure Fraction | |||
| Helix | 0.133 | ||
| turn | 0.469 | ||
| sheet | 0.115 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255714.1 | 5prime_partial | 135 | 2-409(+) |
Amino Acid sequence : | |||
| VTFRGPSDAHLDSLVGQALFGDGAAAVIVGSDPIVGVERPLFELVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFAPLGISDWNSVFWIAHPGGAAILQQVES KLGLKPEKLNSRPTC* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 12,270.571 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 85.666 | ||
| aromaticity | 0.071 | ||
| GRAVY | -1.156 | ||
Secondary Structure Fraction | |||
| Helix | 0.133 | ||
| turn | 0.469 | ||
| sheet | 0.115 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255714.1 | 5prime_partial | 113 | 560-219(-) |
Amino Acid sequence : | |||
| KDPFSTGARPKPNRTPQSSPSRGSSALPGGDFFISSRMNKTQALDMFPYSLSTWGVNSVSRASAPAWTPPVGGWRPPRGGRSRKRSSNRKSPRGRRPPSDSSRCSSRSARARP* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,270.571 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 85.666 | ||
| aromaticity | 0.071 | ||
| GRAVY | -1.156 | ||
Secondary Structure Fraction | |||
| Helix | 0.133 | ||
| turn | 0.469 | ||
| sheet | 0.115 | ||