Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255714.1 | internal | 187 | 1-561(+) |
Amino Acid sequence : | |||
RHLPRPQRRPPRQPRRPGPLRRRRRRRHRRLRPHRRRRAPPLRAGLRRPDDPPRQRRRHRRPPPGGGPHLPPPQGRARADLEEHREESEGGLRPLGDFRLELRFLDRPPRGGRHPPTGGV QAGAEARETEFTPHVLSEYGNMSSACVLFILDEMKKSPPGRAELPREGLDWGVLFGFGRAPVEKGSF | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 12,270.571 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 85.666 | ||
aromaticity | 0.071 | ||
GRAVY | -1.156 | ||
Secondary Structure Fraction | |||
Helix | 0.133 | ||
turn | 0.469 | ||
sheet | 0.115 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255714.1 | internal | 187 | 561-1(-) |
Amino Acid sequence : | |||
EGPLFHGSPAETEQNPPVQPFPGEFSPSRGRFLHFIKNEQNAGARHVPVLAQHVGREFSFSGFSPSLDSTCWRMAAPPGWAIQKTEFQSEIPKGAKASFRLFSMFFEISPGTSLRRWKVR PTSRRWPSMAPSLSGRIVWAAETSSKRGRSTPTMGSEPTMTAAAPSPKRAWPTRLSRWASLGPRKVT | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 12,270.571 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 85.666 | ||
aromaticity | 0.071 | ||
GRAVY | -1.156 | ||
Secondary Structure Fraction | |||
Helix | 0.133 | ||
turn | 0.469 | ||
sheet | 0.115 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255714.1 | 5prime_partial | 135 | 2-409(+) |
Amino Acid sequence : | |||
VTFRGPSDAHLDSLVGQALFGDGAAAVIVGSDPIVGVERPLFELVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFAPLGISDWNSVFWIAHPGGAAILQQVES KLGLKPEKLNSRPTC* | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 12,270.571 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 85.666 | ||
aromaticity | 0.071 | ||
GRAVY | -1.156 | ||
Secondary Structure Fraction | |||
Helix | 0.133 | ||
turn | 0.469 | ||
sheet | 0.115 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255714.1 | 5prime_partial | 113 | 560-219(-) |
Amino Acid sequence : | |||
KDPFSTGARPKPNRTPQSSPSRGSSALPGGDFFISSRMNKTQALDMFPYSLSTWGVNSVSRASAPAWTPPVGGWRPPRGGRSRKRSSNRKSPRGRRPPSDSSRCSSRSARARP* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,270.571 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 85.666 | ||
aromaticity | 0.071 | ||
GRAVY | -1.156 | ||
Secondary Structure Fraction | |||
Helix | 0.133 | ||
turn | 0.469 | ||
sheet | 0.115 |