| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255716.1 | internal | 140 | 1-420(+) |
Amino Acid sequence : | |||
| HTHTHTEKKEKTKKNMSLITDEIRSAASEMYRGDEICQEKSKFLLTEMGLPNGLLPMKDIVEVGYVKDTGFVWLIQKKKCDHRFEKIGRPVQVRRRGHRLRGAEEDQEAHRRQGQGAHDV AYHLRYFPSTDPPTGKITFK | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 16,272.419 | ||
| Theoretical pI: | 9.488 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 43.782 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.962 | ||
Secondary Structure Fraction | |||
| Helix | 0.236 | ||
| turn | 0.171 | ||
| sheet | 0.221 | ||