Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255723.1 | 5prime_partial | 153 | 2-463(+) |
Amino Acid sequence : | |||
FDRLMYSGKGVAFAPYGEHWRNARSMCMLQLLSAKRVQSFGGIREEETSAMIEKIRRSKPTTVVNLSEMFMALTNGVIHRAVLGRKGDGGDDFNRILIKVIKLLGSFHVGDYVPWLSWIY RINGVHAKMEKIRSKLDGINGRFSPKYLKEEGG* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 17,351.020 | ||
Theoretical pI: | 9.948 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 23950 | ||
Instability index: | 42.661 | ||
aromaticity | 0.098 | ||
GRAVY | -0.274 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.248 | ||
sheet | 0.242 |