Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255725.1	internal	201	3-605(+)
Amino Acid sequence :
STKNTSVEEIRRSVTYHPSVWRDHFLAYTNDVTEISAAEKEQLEKQKEKVKNLLAQTPNDSTLKIDLIDAIQRLGLGYHFEEEIDGSLRKIHDSYEMLSSKGEDDVRVLALRFRLLRQQG YRVPCEVFNKLVDDEGNFKESLINDVEGMLSLYEASNYGINGEEIMDKASEFSSSHLDDPSQKNPLSFKQMKNFGICRIPD
Physicochemical properties
Number of amino acids:		201
Molecular weight:		23,080.570
Theoretical pI:		5.064
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15930 16055
Instability index:		31.773
aromaticity		0.080
GRAVY		-0.670
Secondary Structure Fraction
Helix		0.294
turn		0.229
sheet		0.259